Lineage for d1j1ph_ (1j1p H:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511324Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (31 PDB entries)
  8. 1511329Domain d1j1ph_: 1j1p H: [77060]
    Other proteins in same PDB: d1j1pl_, d1j1py_
    part of Fv HyHEL-10
    mutant

Details for d1j1ph_

PDB Entry: 1j1p (more details), 1.8 Å

PDB Description: crystal structure of hyhel-10 fv mutant ls91a complexed with hen egg white lysozyme
PDB Compounds: (H:) Ig VH,anti-lysozyme

SCOPe Domain Sequences for d1j1ph_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1ph_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

SCOPe Domain Coordinates for d1j1ph_:

Click to download the PDB-style file with coordinates for d1j1ph_.
(The format of our PDB-style files is described here.)

Timeline for d1j1ph_: