Lineage for d1j1ph_ (1j1p H:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219787Species Fab HyHEL-10 (mouse), kappa L chain [48788] (8 PDB entries)
  8. 219790Domain d1j1ph_: 1j1p H: [77060]
    Other proteins in same PDB: d1j1py_
    Fv fragment only
    mutant

Details for d1j1ph_

PDB Entry: 1j1p (more details), 1.8 Å

PDB Description: Crystal structure of HyHEL-10 Fv mutant LS91A complexed with hen egg white lysozyme
PDB Compounds: (H:)

SCOP Domain Sequences for d1j1ph_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1ph_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-10 (mouse), kappa L chain}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

SCOP Domain Coordinates for d1j1ph_:

Click to download the PDB-style file with coordinates for d1j1ph_.
(The format of our PDB-style files is described here.)

Timeline for d1j1ph_: