Lineage for d1j1ha_ (1j1h A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1811934Fold b.111: Small protein B (SmpB) [74981] (1 superfamily)
    barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold
  4. 1811935Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) (S)
  5. 1811936Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein)
  6. 1811937Protein Small protein B (SmpB) [74984] (2 species)
    tmRNA-binding protein; SsrA-binding protein
  7. 1811942Species Thermus thermophilus [TaxId:274] [82130] (5 PDB entries)
    Uniprot Q8RR57 4-123
  8. 1811948Domain d1j1ha_: 1j1h A: [77056]

Details for d1j1ha_

PDB Entry: 1j1h (more details)

PDB Description: solution structure of a tmrna-binding protein, smpb, from thermus thermophilus
PDB Compounds: (A:) Small Protein B

SCOPe Domain Sequences for d1j1ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1ha_ b.111.1.1 (A:) Small protein B (SmpB) {Thermus thermophilus [TaxId: 274]}
mapvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyi
apyekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllgla
rgk

SCOPe Domain Coordinates for d1j1ha_:

Click to download the PDB-style file with coordinates for d1j1ha_.
(The format of our PDB-style files is described here.)

Timeline for d1j1ha_: