Class b: All beta proteins [48724] (180 folds) |
Fold b.111: Small protein B (SmpB) [74981] (2 superfamilies) barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold |
Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) |
Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein) |
Protein Small protein B (SmpB) [74984] (2 species) tmRNA-binding protein; SsrA-binding protein |
Species Thermus thermophilus [TaxId:274] [82130] (5 PDB entries) Uniprot Q8RR57 4-123 |
Domain d1j1ha_: 1j1h A: [77056] |
PDB Entry: 1j1h (more details)
SCOPe Domain Sequences for d1j1ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j1ha_ b.111.1.1 (A:) Small protein B (SmpB) {Thermus thermophilus [TaxId: 274]} mapvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyi apyekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllgla rgk
Timeline for d1j1ha_: