Lineage for d1j14a_ (1j14 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1794264Protein Trypsin(ogen) [50515] (9 species)
  7. 1794751Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (36 PDB entries)
  8. 1794778Domain d1j14a_: 1j14 A: [77052]
    complexed with ben, ca, so4; mutant

Details for d1j14a_

PDB Entry: 1j14 (more details), 2.4 Å

PDB Description: benzamidine in complex with rat trypsin mutant x99rt
PDB Compounds: (A:) trypsin II, anionic

SCOPe Domain Sequences for d1j14a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j14a_ b.47.1.2 (A:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdretynndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

SCOPe Domain Coordinates for d1j14a_:

Click to download the PDB-style file with coordinates for d1j14a_.
(The format of our PDB-style files is described here.)

Timeline for d1j14a_: