Lineage for d1j0ta_ (1j0t A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018069Fold a.163: Crustacean CHH/MIH/GIH neurohormone [81777] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2018070Superfamily a.163.1: Crustacean CHH/MIH/GIH neurohormone [81778] (1 family) (S)
    automatically mapped to Pfam PF01147
  5. 2018071Family a.163.1.1: Crustacean CHH/MIH/GIH neurohormone [81779] (1 protein)
  6. 2018072Protein Mlt-inhibiting hormone (MIH) [81780] (1 species)
  7. 2018073Species Kuruma prawn (Marsupenaeus japonicus) [TaxId:27405] [81781] (1 PDB entry)
  8. 2018074Domain d1j0ta_: 1j0t A: [77051]

Details for d1j0ta_

PDB Entry: 1j0t (more details)

PDB Description: the solution structure of molt-inhibiting hormone from the kuruma prawn
PDB Compounds: (A:) molt-inhibiting hormone

SCOPe Domain Sequences for d1j0ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0ta_ a.163.1.1 (A:) Mlt-inhibiting hormone (MIH) {Kuruma prawn (Marsupenaeus japonicus) [TaxId: 27405]}
asfidntcrgvmgnrdiykkvvrvcedctnifrlpgldgmcrnrcfynewfliclkaanr
edeiekfrvwisilnagq

SCOPe Domain Coordinates for d1j0ta_:

Click to download the PDB-style file with coordinates for d1j0ta_.
(The format of our PDB-style files is described here.)

Timeline for d1j0ta_: