SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1j0kb2 (1j0k B:506-588)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066963Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2066964Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2066965Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 protein domains)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2067335Protein Neopullulanase [82175] (1 species)
    homologous to Maltogenic amylase
  7. 2067336Species Bacillus stearothermophilus [TaxId:1422] [82176] (4 PDB entries)
  8. 2067344Domain d1j0kb2: 1j0k B:506-588 [77049]
    Other proteins in same PDB: d1j0ka1, d1j0ka3, d1j0kb1, d1j0kb3

Details for d1j0kb2

PDB Entry: 1j0k (more details), 3.2 Å

PDB Description: Crystal structure of neopullulanase E357Q complex with isopanose
PDB Compounds: (B:) neopullulanase

SCOPe Domain Sequences for d1j0kb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0kb2 b.71.1.1 (B:506-588) Neopullulanase {Bacillus stearothermophilus [TaxId: 1422]}
geisflhaddemnyliykktdgdetvlviinrsdqkadipipldargtwlvnlltgerfa
aeaetlctslppygfvlyaiehw

SCOPe Domain Coordinates for d1j0kb2:

Click to download the PDB-style file with coordinates for d1j0kb2.
(The format of our PDB-style files is described here.)

Timeline for d1j0kb2: