Class b: All beta proteins [48724] (174 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Neopullulanase [82175] (1 species) homologous to Maltogenic amylase |
Species Bacillus stearothermophilus [TaxId:1422] [82176] (4 PDB entries) |
Domain d1j0jb2: 1j0j B:506-588 [77043] Other proteins in same PDB: d1j0ja1, d1j0ja3, d1j0jb1, d1j0jb3 complexed with glc; mutant |
PDB Entry: 1j0j (more details), 2.8 Å
SCOP Domain Sequences for d1j0jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j0jb2 b.71.1.1 (B:506-588) Neopullulanase {Bacillus stearothermophilus [TaxId: 1422]} geisflhaddemnyliykktdgdetvlviinrsdqkadipipldargtwlvnlltgerfa aeaetlctslppygfvlyaiehw
Timeline for d1j0jb2: