SCOPe 2.06: Domain d1j0ja3: 1j0j A:124-505

Lineage for d1j0ja3 (1j0j A:124-505)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Neopullulanase, central domain [82240] (1 species)
   homologous to Maltogenic amylase

7. Species Bacillus stearothermophilus [TaxId:1422] [82241] (4 PDB entries)

8. Domain d1j0ja3: 1j0j A:124-505 [77041]
   Other proteins in same PDB: d1j0ja1, d1j0ja2, d1j0jb1, d1j0jb2

Details for d1j0ja3

PDB Entry: 1j0j, 2.8 Å

PDB Description: crystal structure of neopullulanase e357q complex with maltotetraose

PDB Compounds: (A:) neopullulanase

SCOPe Domain Sequences for d1j0ja3:

Sequence; same for both SEQRES and ATOM records:

>d1j0ja3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]}
dlfeapdwvkdtvwyqifperfangnpsispegsrpwgsedptptsffggdlqgiidhld
ylvdlgitgiyltpifrspsnhkydtadyfevdphfgdketlktlidrchekgirvmlda
vfnhcgyefapfqdvwkngesskykdwfhihefplqteprpnydtfafvpqmpklntanp
evkrylldvatywirefdidgwrldvaneidhefwrefrqevkalkpdvyilgqiwhdam
pwlrgdqfdavmnypftdgvlrffakeeisarqfanqmmhvlhsypnnvneaafnllgsh
dtsriltvcggdirkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpmqqn
kelhqhvkqlialrkqyrslrr

Timeline for d1j0ja3:

• d1j0ja3 first appeared in SCOP 1.63
  
• d1j0ja3 appears in SCOPe 2.05
  
• d1j0ja3 appears in SCOPe 2.07
  
• d1j0ja3 appears in the current release, SCOPe 2.08