SCOP 1.63: Domain d1j0ja2: 1j0j A:506-588

Lineage for d1j0ja2 (1j0j A:506-588)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (18 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Neopullulanase [82175] (1 species)
   homologous to Maltogenic amylase

7. Species Bacillus stearothermophilus [TaxId:1422] [82176] (4 PDB entries)

8. Domain d1j0ja2: 1j0j A:506-588 [77040]
   Other proteins in same PDB: d1j0ja1, d1j0ja3, d1j0jb1, d1j0jb3

Details for d1j0ja2

PDB Entry: 1j0j, 2.8 Å

PDB Description: crystal structure of neopullulanase e357q complex with maltotetraose

SCOP Domain Sequences for d1j0ja2:

Sequence; same for both SEQRES and ATOM records:

>d1j0ja2 b.71.1.1 (A:506-588) Neopullulanase {Bacillus stearothermophilus}
geisflhaddemnyliykktdgdetvlviinrsdqkadipipldargtwlvnlltgerfa
aeaetlctslppygfvlyaiehw

Timeline for d1j0ja2:

• d1j0ja2 is new in SCOP 1.63
  
• d1j0ja2 appears in SCOP 1.65
  
• d1j0ja2 appears in the current release, SCOPe 2.08