Lineage for d1j0hb2 (1j0h B:506-588)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810722Protein Neopullulanase [82175] (1 species)
    homologous to Maltogenic amylase
  7. 2810723Species Bacillus stearothermophilus [TaxId:1422] [82176] (4 PDB entries)
  8. 2810725Domain d1j0hb2: 1j0h B:506-588 [77031]
    Other proteins in same PDB: d1j0ha1, d1j0ha3, d1j0hb1, d1j0hb3
    complexed with ca, cl

Details for d1j0hb2

PDB Entry: 1j0h (more details), 1.9 Å

PDB Description: Crystal structure of Bacillus stearothermophilus neopullulanase
PDB Compounds: (B:) neopullulanase

SCOPe Domain Sequences for d1j0hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0hb2 b.71.1.1 (B:506-588) Neopullulanase {Bacillus stearothermophilus [TaxId: 1422]}
geisflhaddemnyliykktdgdetvlviinrsdqkadipipldargtwlvnlltgerfa
aeaetlctslppygfvlyaiehw

SCOPe Domain Coordinates for d1j0hb2:

Click to download the PDB-style file with coordinates for d1j0hb2.
(The format of our PDB-style files is described here.)

Timeline for d1j0hb2: