SCOP 1.63: Domain d1j0hb1: 1j0h B:1-123

Lineage for d1j0hb1 (1j0h B:1-123)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (17 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location

6. Protein Neopullulanase, central domain [81960] (1 species)
   homologous to Maltogenic amylase

7. Species Bacillus stearothermophilus [TaxId:1422] [81961] (4 PDB entries)

8. Domain d1j0hb1: 1j0h B:1-123 [77030]
   Other proteins in same PDB: d1j0ha2, d1j0ha3, d1j0hb2, d1j0hb3
   complexed with ca, cl

Details for d1j0hb1

PDB Entry: 1j0h, 1.9 Å

PDB Description: Crystal structure of Bacillus stearothermophilus neopullulanase

SCOP Domain Sequences for d1j0hb1:

Sequence; same for both SEQRES and ATOM records:

>d1j0hb1 b.1.18.2 (B:1-123) Neopullulanase, central domain {Bacillus stearothermophilus}
mrkeaiyhrpadnfayaydsetlhlrlrtkkddidrvellhgdpydwqngawqfqmmpmr
ktgsdelfdywfaevkppyrrlrygfvlysgeeklvytekgfyfevptddtayyfcfpfl
hrv

Timeline for d1j0hb1:

• d1j0hb1 is new in SCOP 1.63
  
• d1j0hb1 appears in SCOP 1.65
  
• d1j0hb1 appears in the current release, SCOPe 2.08