Lineage for d1j09a2 (1j09 A:1-305)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2118899Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2118944Protein Glutamyl-tRNA synthetase (GluRS) [52382] (1 species)
    Catalytic domain is very similar to that of GlnRS
  7. 2118945Species Thermus thermophilus [TaxId:274] [52383] (11 PDB entries)
  8. 2118946Domain d1j09a2: 1j09 A:1-305 [77026]
    Other proteins in same PDB: d1j09a1
    protein/RNA complex; complexed with atp, glu, mg

Details for d1j09a2

PDB Entry: 1j09 (more details), 1.8 Å

PDB Description: Crystal structure of Thermus thermophilus glutamyl-tRNA synthetase complexed with ATP and Glu
PDB Compounds: (A:) Glutamyl-tRNA synthetase

SCOPe Domain Sequences for d1j09a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j09a2 c.26.1.1 (A:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]}
mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal
kwlglsydegpdvggphgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg
gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk
sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd
ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl
ggpvf

SCOPe Domain Coordinates for d1j09a2:

Click to download the PDB-style file with coordinates for d1j09a2.
(The format of our PDB-style files is described here.)

Timeline for d1j09a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j09a1