Lineage for d1j01a_ (1j01 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 384721Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 385002Protein Xylanase A, catalytic core [51514] (7 species)
  7. 385003Species Cellulomonas fimi [TaxId:1708] [51520] (9 PDB entries)
    synonym: beta-1,4-glycanase Cex
  8. 385012Domain d1j01a_: 1j01 A: [77020]
    complexed with xil

Details for d1j01a_

PDB Entry: 1j01 (more details), 2 Å

PDB Description: crystal structure of the xylanase cex with xylobiose-derived inhibitor isofagomine lactam

SCOP Domain Sequences for d1j01a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j01a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi}
attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
kkpayaavmeaf

SCOP Domain Coordinates for d1j01a_:

Click to download the PDB-style file with coordinates for d1j01a_.
(The format of our PDB-style files is described here.)

Timeline for d1j01a_: