Lineage for d1izlv_ (1izl V:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 432921Fold i.5: Photosystems [58155] (1 superfamily)
  4. 432922Superfamily i.5.1: Photosystems [58156] (1 family) (S)
  5. 432923Family i.5.1.1: Photosystems [58157] (5 proteins)
    not a true family
  6. 432937Protein Photosystem II [58160] (2 species)
    there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains
  7. 432975Species Thermosynechococcus vulcanus and Thermosynechococcus elongatus, bp-1 [82945] (1 PDB entry)
  8. 432999Domain d1izlv_: 1izl V: [77015]

Details for d1izlv_

PDB Entry: 1izl (more details), 3.7 Å

PDB Description: crystal structure of photosystem ii

SCOP Domain Sequences for d1izlv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1izlv_ i.5.1.1 (V:) Photosystem II {Thermosynechococcus vulcanus and Thermosynechococcus elongatus, bp-1}
eltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetlal
atpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghilv
epkilgdkw

SCOP Domain Coordinates for d1izlv_:

Click to download the PDB-style file with coordinates for d1izlv_.
(The format of our PDB-style files is described here.)

Timeline for d1izlv_: