Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.5: Photosystems [58155] (1 superfamily) |
Superfamily i.5.1: Photosystems [58156] (1 family) |
Family i.5.1.1: Photosystems [58157] (5 proteins) not a true family |
Protein Photosystem II [58160] (2 species) there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains |
Species Thermosynechococcus vulcanus [TaxId:32053] [82945] (2 PDB entries) |
Domain d1izle_: 1izl E: [76998] complexed with bcr, cla, fe, hem, mn, pho, pla |
PDB Entry: 1izl (more details), 3.7 Å
SCOPe Domain Sequences for d1izle_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1izle_ i.5.1.1 (E:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]} rpfsdiitsvrywvihsitipalfiagwlfvstgl
Timeline for d1izle_:
View in 3D Domains from other chains: (mouse over for more information) d1izl0_, d1izl1_, d1izla_, d1izlb_, d1izlc_, d1izld_, d1izlf_, d1izlg_, d1izlh_, d1izli_, d1izlj_, d1izlk_, d1izll_, d1izlm_, d1izln_, d1izlo_, d1izlp_, d1izlq_, d1izlr_, d1izls_, d1izlt_, d1izlu_, d1izlv_, d1izlw_, d1izlx_, d1izly_, d1izlz_ |