SCOPe 2.08: Domain d1izle_: 1izl E:

Lineage for d1izle_ (1izl E:)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.5: Photosystems [58155] (1 superfamily)

4. Superfamily i.5.1: Photosystems [58156] (1 family)

5. Family i.5.1.1: Photosystems [58157] (5 proteins)
   not a true family

6. Protein Photosystem II [58160] (2 species)
   there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains

7. Species Thermosynechococcus vulcanus [TaxId:32053] [82945] (2 PDB entries)

8. Domain d1izle_: 1izl E: [76998]
   complexed with bcr, cla, fe, hem, mn, pho, pla

Details for d1izle_

PDB Entry: 1izl, 3.7 Å

PDB Description: crystal structure of photosystem ii

PDB Compounds: (E:) photosystem II: subunit psbe

SCOPe Domain Sequences for d1izle_:

Sequence; same for both SEQRES and ATOM records:

>d1izle_ i.5.1.1 (E:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
rpfsdiitsvrywvihsitipalfiagwlfvstgl

Timeline for d1izle_:

• d1izle_ first appeared in SCOP 1.63
  
• d1izle_ appears in SCOPe 2.07