SCOPe 2.04: Domain d1iz9b2: 1iz9 B:155-327

Lineage for d1iz9b2 (1iz9 B:155-327)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Malate dehydrogenase [56329] (12 species)

7. Species Thermus thermophilus [TaxId:274] [82806] (7 PDB entries)
   identical sequence to that from the Thermus flavus enzyme

8. Domain d1iz9b2: 1iz9 B:155-327 [76987]
   Other proteins in same PDB: d1iz9a1, d1iz9b1

Details for d1iz9b2

PDB Entry: 1iz9, 2 Å

PDB Description: Crystal Structure of Malate Dehydrogenase from Thermus thermophilus HB8

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1iz9b2:

Sequence; same for both SEQRES and ATOM records:

>d1iz9b2 d.162.1.1 (B:155-327) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mtrldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewy
ekvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygi
pegivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli

Timeline for d1iz9b2:

• d1iz9b2 first appeared in SCOP 1.63
  
• d1iz9b2 appears in SCOPe 2.03
  
• d1iz9b2 appears in SCOPe 2.05
  
• d1iz9b2 appears in the current release, SCOPe 2.08