SCOPe 2.05: Domain d1iz9b1: 1iz9 B:1-154

Lineage for d1iz9b1 (1iz9 B:1-154)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Malate dehydrogenase [51849] (13 species)

7. Species Thermus thermophilus [TaxId:274] [82300] (7 PDB entries)
   identical sequence to that from the Thermus flavus enzyme

8. Domain d1iz9b1: 1iz9 B:1-154 [76986]
   Other proteins in same PDB: d1iz9a2, d1iz9b2

Details for d1iz9b1

PDB Entry: 1iz9, 2 Å

PDB Description: Crystal Structure of Malate Dehydrogenase from Thermus thermophilus HB8

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1iz9b1:

Sequence; same for both SEQRES and ATOM records:

>d1iz9b1 c.2.1.5 (B:1-154) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
afpllagleatddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
kkdvkvlvvgnpantnaliayknapglnprnfta

Timeline for d1iz9b1:

• d1iz9b1 first appeared in SCOP 1.63
  
• d1iz9b1 appears in SCOPe 2.04
  
• d1iz9b1 appears in SCOPe 2.06
  
• d1iz9b1 appears in the current release, SCOPe 2.08