Lineage for d1iz9a2 (1iz9 A:155-327)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 336217Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 336218Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 336219Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 336280Protein Malate dehydrogenase [56329] (11 species)
  7. 336345Species Thermus thermophilus [TaxId:274] [82806] (1 PDB entry)
    identical sequence to that from the Thermus flavus enzyme
  8. 336346Domain d1iz9a2: 1iz9 A:155-327 [76985]
    Other proteins in same PDB: d1iz9a1, d1iz9b1

Details for d1iz9a2

PDB Entry: 1iz9 (more details), 2 Å

PDB Description: Crystal Structure of Malate Dehydrogenase from Thermus thermophilus HB8

SCOP Domain Sequences for d1iz9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iz9a2 d.162.1.1 (A:155-327) Malate dehydrogenase {Thermus thermophilus}
mtrldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewy
ekvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygi
pegivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli

SCOP Domain Coordinates for d1iz9a2:

Click to download the PDB-style file with coordinates for d1iz9a2.
(The format of our PDB-style files is described here.)

Timeline for d1iz9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iz9a1