Lineage for d1iz6b2 (1iz6 B:71-137)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541496Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1541503Protein C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) [50296] (5 species)
  7. 1541511Species Pyrococcus horikoshii [TaxId:53953] [82104] (1 PDB entry)
  8. 1541513Domain d1iz6b2: 1iz6 B:71-137 [76979]
    Other proteins in same PDB: d1iz6a1, d1iz6b1, d1iz6c1

Details for d1iz6b2

PDB Entry: 1iz6 (more details), 2 Å

PDB Description: Crystal Structure of Translation Initiation Factor 5A from Pyrococcus Horikoshii
PDB Compounds: (B:) Initiation Factor 5A

SCOPe Domain Sequences for d1iz6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iz6b2 b.40.4.5 (B:71-137) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Pyrococcus horikoshii [TaxId: 53953]}
idkktaqviaitpdtvqimdmetyetfevpidtgvadeirdqlkeginveywetlgriki
mrikgeg

SCOPe Domain Coordinates for d1iz6b2:

Click to download the PDB-style file with coordinates for d1iz6b2.
(The format of our PDB-style files is described here.)

Timeline for d1iz6b2: