SCOPe 2.03: Domain d1iz6b2: 1iz6 B:71-137

Lineage for d1iz6b2 (1iz6 B:71-137)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) [50296] (5 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [82104] (1 PDB entry)

8. Domain d1iz6b2: 1iz6 B:71-137 [76979]
   Other proteins in same PDB: d1iz6a1, d1iz6b1, d1iz6c1

Details for d1iz6b2

PDB Entry: 1iz6, 2 Å

PDB Description: Crystal Structure of Translation Initiation Factor 5A from Pyrococcus Horikoshii

PDB Compounds: (B:) Initiation Factor 5A

SCOPe Domain Sequences for d1iz6b2:

Sequence; same for both SEQRES and ATOM records:

>d1iz6b2 b.40.4.5 (B:71-137) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Pyrococcus horikoshii [TaxId: 53953]}
idkktaqviaitpdtvqimdmetyetfevpidtgvadeirdqlkeginveywetlgriki
mrikgeg

Timeline for d1iz6b2:

• d1iz6b2 first appeared in SCOP 1.63
  
• d1iz6b2 appears in SCOPe 2.02
  
• d1iz6b2 appears in SCOPe 2.04
  
• d1iz6b2 appears in the current release, SCOPe 2.08