Lineage for d1iz6b1 (1iz6 B:2-70)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295568Fold b.34: SH3-like barrel [50036] (13 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 295918Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) (S)
    many known members contain KOW motif
  5. 295948Family b.34.5.2: eIF5a N-terminal domain-like [50110] (2 proteins)
  6. 295949Protein Eukaryotic initiation translation factor 5a (eIF5a) [50111] (3 species)
  7. 295955Species Archaeon Pyrococcus horikoshii [TaxId:53953] [82069] (1 PDB entry)
  8. 295957Domain d1iz6b1: 1iz6 B:2-70 [76978]
    Other proteins in same PDB: d1iz6a2, d1iz6b2, d1iz6c2

Details for d1iz6b1

PDB Entry: 1iz6 (more details), 2 Å

PDB Description: Crystal Structure of Translation Initiation Factor 5A from Pyrococcus Horikoshii

SCOP Domain Sequences for d1iz6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iz6b1 b.34.5.2 (B:2-70) Eukaryotic initiation translation factor 5a (eIF5a) {Archaeon Pyrococcus horikoshii}
gdktkvqvsklkpgryiiiddepcrivnitvsspgkhgsakarieavgifdgkvrsivkp
tsaevdvpi

SCOP Domain Coordinates for d1iz6b1:

Click to download the PDB-style file with coordinates for d1iz6b1.
(The format of our PDB-style files is described here.)

Timeline for d1iz6b1: