Lineage for d1iz6a2 (1iz6 A:71-137)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 229103Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 229270Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins)
    barrel, closed; n=5, S=8
  6. 229277Protein C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) [50296] (3 species)
  7. 229283Species Archaeon Pyrococcus horikoshii [TaxId:53953] [82104] (1 PDB entry)
  8. 229284Domain d1iz6a2: 1iz6 A:71-137 [76977]
    Other proteins in same PDB: d1iz6a1, d1iz6b1, d1iz6c1

Details for d1iz6a2

PDB Entry: 1iz6 (more details), 2 Å

PDB Description: Crystal Structure of Translation Initiation Factor 5A from Pyrococcus Horikoshii

SCOP Domain Sequences for d1iz6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iz6a2 b.40.4.5 (A:71-137) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Archaeon Pyrococcus horikoshii}
idkktaqviaitpdtvqimdmetyetfevpidtgvadeirdqlkeginveywetlgriki
mrikgeg

SCOP Domain Coordinates for d1iz6a2:

Click to download the PDB-style file with coordinates for d1iz6a2.
(The format of our PDB-style files is described here.)

Timeline for d1iz6a2: