Lineage for d1iyra_ (1iyr A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014033Fold a.164: C-terminal domain of DFF45/ICAD (DFF-C domain) [81782] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2014034Superfamily a.164.1: C-terminal domain of DFF45/ICAD (DFF-C domain) [81783] (1 family) (S)
  5. 2014035Family a.164.1.1: C-terminal domain of DFF45/ICAD (DFF-C domain) [81784] (1 protein)
  6. 2014036Protein C-terminal domain of DFF45/ICAD (DFF-C domain) [81785] (1 species)
    present only in a long splicing variant of DFF45; essential for chaperone activity
  7. 2014037Species Human (Homo sapiens) [TaxId:9606] [81786] (2 PDB entries)
  8. 2014039Domain d1iyra_: 1iyr A: [76973]

Details for d1iyra_

PDB Entry: 1iyr (more details)

PDB Description: NMR Structure Ensemble Of Dff-C Domain
PDB Compounds: (A:) DNA fragmentation factor alpha subunit

SCOPe Domain Sequences for d1iyra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyra_ a.164.1.1 (A:) C-terminal domain of DFF45/ICAD (DFF-C domain) {Human (Homo sapiens) [TaxId: 9606]}
tgisretssdvalashiltalrekqapelslssqdlelvtkedpkalavalnwdikktet
vqeacerelalrlqqtqslhslr

SCOPe Domain Coordinates for d1iyra_:

Click to download the PDB-style file with coordinates for d1iyra_.
(The format of our PDB-style files is described here.)

Timeline for d1iyra_: