Lineage for d1iypa_ (1iyp A:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1232773Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1232774Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1232775Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1232943Protein beta-Lactamase, class A [56606] (15 species)
  7. 1233006Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (16 PDB entries)
  8. 1233018Domain d1iypa_: 1iyp A: [76971]
    complexed with cep, so4

Details for d1iypa_

PDB Entry: 1iyp (more details), 2 Å

PDB Description: toho-1 beta-lactamase in complex with cephalothin
PDB Compounds: (A:) Toho-1 beta-lactamase

SCOPe Domain Sequences for d1iypa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iypa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]}
svqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdk
hllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkv
tafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlv
twlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeq
kaerrrdilaaaakivthgf

SCOPe Domain Coordinates for d1iypa_:

Click to download the PDB-style file with coordinates for d1iypa_.
(The format of our PDB-style files is described here.)

Timeline for d1iypa_: