Lineage for d1iyoa_ (1iyo A:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 338664Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 338665Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 338666Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (9 proteins)
  6. 338739Protein beta-Lactamase, class A [56606] (14 species)
  7. 338777Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (4 PDB entries)
  8. 338778Domain d1iyoa_: 1iyo A: [76970]
    complexed with cef, so4; mutant

Details for d1iyoa_

PDB Entry: 1iyo (more details), 1.8 Å

PDB Description: toho-1 beta-lactamase in complex with cefotaxime

SCOP Domain Sequences for d1iyoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyoa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1}
svqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdk
hllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkv
tafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlv
twlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeq
kaerrrdilaaaakivthgf

SCOP Domain Coordinates for d1iyoa_:

Click to download the PDB-style file with coordinates for d1iyoa_.
(The format of our PDB-style files is described here.)

Timeline for d1iyoa_: