SCOPe 2.03: Domain d1iylb1: 1iyl B:72-224

Lineage for d1iylb1 (1iyl B:72-224)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
   duplication: consists of two NAT-like domains swapped with the C-terminal strands

6. Protein N-myristoyl transferase, NMT [55749] (3 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [55751] (3 PDB entries)

8. Domain d1iylb1: 1iyl B:72-224 [76964]
   complexed with r64

Details for d1iylb1

PDB Entry: 1iyl, 3.2 Å

PDB Description: Crystal Structure of Candida albicans N-myristoyltransferase with Non-peptidic Inhibitor

PDB Compounds: (B:) Myristoyl-CoA:Protein N-Myristoyltransferase

SCOPe Domain Sequences for d1iylb1:

Sequence; same for both SEQRES and ATOM records:

>d1iylb1 d.108.1.2 (B:72-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]}
vpndplplisdfewstldiddnlqldelykllydnyvedidatfrfkysheffqwalkpp
gwrkdwhvgvrvkstgklvafiaatpvtfklnksnkvidsveinflcihkklrnkrlapv
likeitrrvnkqniwqalytggsilptplttcr

Timeline for d1iylb1:

• d1iylb1 first appeared in SCOP 1.63
  
• d1iylb1 appears in SCOPe 2.02
  
• d1iylb1 appears in SCOPe 2.04
  
• d1iylb1 appears in the current release, SCOPe 2.08