SCOP 1.69: Domain d1iykb2: 1iyk B:225-451

Lineage for d1iykb2 (1iyk B:225-451)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families)

5. Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
   duplication: consists of two NAT-like domains swapped with the C-terminal strands

6. Protein N-myristoyl transferase, NMT [55749] (2 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [55751] (3 PDB entries)

8. Domain d1iykb2: 1iyk B:225-451 [76961]

Details for d1iykb2

PDB Entry: 1iyk, 2.3 Å

PDB Description: Crystal structure of candida albicans N-myristoyltransferase with myristoyl-COA and peptidic inhibitor

SCOP Domain Sequences for d1iykb2:

Sequence; same for both SEQRES and ATOM records:

>d1iykb2 d.108.1.2 (B:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans)}
yqhrpinwsklhdvgfshlppnqtkssmvasytlpnnpklkglrpmtgkdvstvlsllyk
yqerfdivqlfteeefkhwmlghdensdsnvvksyvvedengiitdyfsyyllpftvldn
aqhdelgiaylfyyasdsfekpnykkrlnelitdalitskkfgvdvfncltcqdntyflk
dckfgsgdgflnyylfnyrtfpmdggidkktkevvedqtsgigvvll

Timeline for d1iykb2:

• d1iykb2 first appeared in SCOP 1.63
  
• d1iykb2 appears in SCOP 1.67
  
• d1iykb2 appears in SCOP 1.71
  
• d1iykb2 appears in the current release, SCOPe 2.08