Lineage for d1iyka2 (1iyk A:225-451)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 731320Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 731321Protein N-myristoyl transferase, NMT [55749] (3 species)
  7. 731340Species Yeast (Candida albicans) [TaxId:5476] [55751] (3 PDB entries)
  8. 731342Domain d1iyka2: 1iyk A:225-451 [76959]

Details for d1iyka2

PDB Entry: 1iyk (more details), 2.3 Å

PDB Description: Crystal structure of candida albicans N-myristoyltransferase with myristoyl-COA and peptidic inhibitor
PDB Compounds: (A:) Myristoyl-CoA:Protein N-Myristoyltransferase

SCOP Domain Sequences for d1iyka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyka2 d.108.1.2 (A:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]}
yqhrpinwsklhdvgfshlppnqtkssmvasytlpnnpklkglrpmtgkdvstvlsllyk
yqerfdivqlfteeefkhwmlghdensdsnvvksyvvedengiitdyfsyyllpftvldn
aqhdelgiaylfyyasdsfekpnykkrlnelitdalitskkfgvdvfncltcqdntyflk
dckfgsgdgflnyylfnyrtfpmdggidkktkevvedqtsgigvvll

SCOP Domain Coordinates for d1iyka2:

Click to download the PDB-style file with coordinates for d1iyka2.
(The format of our PDB-style files is described here.)

Timeline for d1iyka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iyka1