| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) ![]() |
| Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein) duplication: consists of two NAT-like domains swapped with the C-terminal strands |
| Protein N-myristoyl transferase, NMT [55749] (3 species) |
| Species Yeast (Candida albicans) [TaxId:5476] [55751] (3 PDB entries) |
| Domain d1iyka1: 1iyk A:60-224 [76958] |
PDB Entry: 1iyk (more details), 2.3 Å
SCOP Domain Sequences for d1iyka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]}
egpidklktpedvpndplplisdfewstldiddnlqldelykllydnyvedidatfrfky
sheffqwalkppgwrkdwhvgvrvkstgklvafiaatpvtfklnksnkvidsveinflci
hkklrnkrlapvlikeitrrvnkqniwqalytggsilptplttcr
Timeline for d1iyka1: