Lineage for d1iyjd4 (1iyj D:2732-2760,D:2898-2979)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668080Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 668108Protein OB-fold domains of BRCA2 [82099] (2 species)
    duplication: tandem repeat of three OB-fold domains
  7. 668116Species Rat (Rattus norvegicus) [TaxId:10116] [82101] (1 PDB entry)
  8. 668121Domain d1iyjd4: 1iyj D:2732-2760,D:2898-2979 [76956]
    Other proteins in same PDB: d1iyjb1, d1iyjb2, d1iyjd1, d1iyjd2

Details for d1iyjd4

PDB Entry: 1iyj (more details), 3.4 Å

PDB Description: structure of a brca2-dss1 complex
PDB Compounds: (D:) breast cancer susceptibility

SCOP Domain Sequences for d1iyjd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyjd4 b.40.4.3 (D:2732-2760,D:2898-2979) OB-fold domains of BRCA2 {Rat (Rattus norvegicus) [TaxId: 10116]}
plplsslfsdggnvgcvdvivqrvyplqwXvwklrvtsykkreksallsiwrpssdlpsl
ltegqryriyhlsvsksknkfewpsiqltatkrtqyqqlpvssetllqlyqp

SCOP Domain Coordinates for d1iyjd4:

Click to download the PDB-style file with coordinates for d1iyjd4.
(The format of our PDB-style files is described here.)

Timeline for d1iyjd4: