SCOP 1.75: Domain d1iyjd2: 1iyj D:2761-2897

Lineage for d1iyjd2 (1iyj D:2761-2897)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.171: BRCA2 tower domain [81877] (1 superfamily)
   multihelical; contains a 3-helical Hin recombinase-like subdomain and two long dimerisation helices

4. Superfamily a.171.1: BRCA2 tower domain [81878] (1 family)

5. Family a.171.1.1: BRCA2 tower domain [81879] (1 protein)

6. Protein BRCA2 tower domain [81880] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [81882] (1 PDB entry)

8. Domain d1iyjd2: 1iyj D:2761-2897 [76954]
   Other proteins in same PDB: d1iyjb1, d1iyjb3, d1iyjb4, d1iyjb5, d1iyjd1, d1iyjd3, d1iyjd4, d1iyjd5
   this domain is poorly ordered in the crystal structure

Details for d1iyjd2

PDB Entry: 1iyj, 3.4 Å

PDB Description: structure of a brca2-dss1 complex

PDB Compounds: (D:) breast cancer susceptibility

SCOP Domain Sequences for d1iyjd2:

Sequence, based on SEQRES records:

>d1iyjd2 a.171.1.1 (D:2761-2897) BRCA2 tower domain {Rat (Rattus norvegicus) [TaxId: 10116]}
vektvsgsyifrnereeekealrfaeaqqkklealftkvhtelkeheediaqrrvlsral
trqqvhalqdgaelyaavqdasdpehletcfseeqlralnnyrqmlsdkkqariqsefrk
aleaaekeeglsrdvst

Sequence, based on observed residues (ATOM records):

>d1iyjd2 a.171.1.1 (D:2761-2897) BRCA2 tower domain {Rat (Rattus norvegicus) [TaxId: 10116]}
vektvsgsyifrnereeekealrfsrdvst

Timeline for d1iyjd2:

• d1iyjd2 first appeared in SCOP 1.63
  
• d1iyjd2 appears in SCOP 1.73
  
• d1iyjd2 appears in SCOPe 2.01
  
• d1iyjd2 appears in the current release, SCOPe 2.08