Class a: All alpha proteins [46456] (284 folds) |
Fold a.171: BRCA2 tower domain [81877] (1 superfamily) multihelical; contains a 3-helical Hin recombinase-like subdomain and two long dimerisation helices |
Superfamily a.171.1: BRCA2 tower domain [81878] (1 family) |
Family a.171.1.1: BRCA2 tower domain [81879] (1 protein) |
Protein BRCA2 tower domain [81880] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [81882] (1 PDB entry) |
Domain d1iyjd2: 1iyj D:2761-2897 [76954] Other proteins in same PDB: d1iyjb1, d1iyjb3, d1iyjb4, d1iyjb5, d1iyjd1, d1iyjd3, d1iyjd4, d1iyjd5 this domain is poorly ordered in the crystal structure |
PDB Entry: 1iyj (more details), 3.4 Å
SCOP Domain Sequences for d1iyjd2:
Sequence, based on SEQRES records: (download)
>d1iyjd2 a.171.1.1 (D:2761-2897) BRCA2 tower domain {Rat (Rattus norvegicus) [TaxId: 10116]} vektvsgsyifrnereeekealrfaeaqqkklealftkvhtelkeheediaqrrvlsral trqqvhalqdgaelyaavqdasdpehletcfseeqlralnnyrqmlsdkkqariqsefrk aleaaekeeglsrdvst
>d1iyjd2 a.171.1.1 (D:2761-2897) BRCA2 tower domain {Rat (Rattus norvegicus) [TaxId: 10116]} vektvsgsyifrnereeekealrfsrdvst
Timeline for d1iyjd2: