Lineage for d1iyjd1 (1iyj D:2403-2598)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735812Fold a.170: BRCA2 helical domain [81871] (1 superfamily)
    multihelical; contains a 3-helical bundle surrounded by several shorter helices
  4. 2735813Superfamily a.170.1: BRCA2 helical domain [81872] (1 family) (S)
    automatically mapped to Pfam PF09169
  5. 2735814Family a.170.1.1: BRCA2 helical domain [81873] (1 protein)
  6. 2735815Protein BRCA2 helical domain [81874] (2 species)
  7. 2735819Species Norway rat (Rattus norvegicus) [TaxId:10116] [81876] (1 PDB entry)
  8. 2735821Domain d1iyjd1: 1iyj D:2403-2598 [76953]
    Other proteins in same PDB: d1iyjb2, d1iyjb3, d1iyjb4, d1iyjb5, d1iyjd2, d1iyjd3, d1iyjd4, d1iyjd5
    complexed with human Dss1 fragment, chains A and C
    protein/DNA complex

Details for d1iyjd1

PDB Entry: 1iyj (more details), 3.4 Å

PDB Description: structure of a brca2-dss1 complex
PDB Compounds: (D:) breast cancer susceptibility

SCOPe Domain Sequences for d1iyjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyjd1 a.170.1.1 (D:2403-2598) BRCA2 helical domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpqfnkdlmsslqnardlqdiriknkerhhlcpqpgslyltksstlprislqaavgdsvp
sacspkqlymygvskacisvnsknaeyfqfaiedhfgkealcagkgfrladggwlipsdd
gkagkeefyralcdtpgvdpklissvwvsnhyrwivwklaamefafpkefanrclnperv
llqlkyrydveidnss

SCOPe Domain Coordinates for d1iyjd1:

Click to download the PDB-style file with coordinates for d1iyjd1.
(The format of our PDB-style files is described here.)

Timeline for d1iyjd1: