Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins) barrel, closed; n=5, S=10 |
Protein OB-fold domains of BRCA2 [82099] (2 species) duplication: tandem repeat of three OB-fold domains |
Species Rat (Rattus norvegicus) [TaxId:10116] [82101] (1 PDB entry) |
Domain d1iyjb4: 1iyj B:2732-2760,B:2898-2979 [76951] Other proteins in same PDB: d1iyjb1, d1iyjb2, d1iyjd1, d1iyjd2 |
PDB Entry: 1iyj (more details), 3.4 Å
SCOP Domain Sequences for d1iyjb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iyjb4 b.40.4.3 (B:2732-2760,B:2898-2979) OB-fold domains of BRCA2 {Rat (Rattus norvegicus) [TaxId: 10116]} plplsslfsdggnvgcvdvivqrvyplqwXvwklrvtsykkreksallsiwrpssdlpsl ltegqryriyhlsvsksknkfewpsiqltatkrtqyqqlpvssetllqlyqp
Timeline for d1iyjb4: