Lineage for d1iyjb1 (1iyj B:2403-2598)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341367Fold a.170: BRCA2 helical domain [81871] (1 superfamily)
    multihelical; contains a 3-helical bundle surrounded by several shorter helices
  4. 2341368Superfamily a.170.1: BRCA2 helical domain [81872] (1 family) (S)
    automatically mapped to Pfam PF09169
  5. 2341369Family a.170.1.1: BRCA2 helical domain [81873] (1 protein)
  6. 2341370Protein BRCA2 helical domain [81874] (2 species)
  7. 2341374Species Norway rat (Rattus norvegicus) [TaxId:10116] [81876] (1 PDB entry)
  8. 2341375Domain d1iyjb1: 1iyj B:2403-2598 [76948]
    Other proteins in same PDB: d1iyjb2, d1iyjb3, d1iyjb4, d1iyjb5, d1iyjd2, d1iyjd3, d1iyjd4, d1iyjd5
    complexed with human Dss1 fragment, chains A and C
    protein/DNA complex

Details for d1iyjb1

PDB Entry: 1iyj (more details), 3.4 Å

PDB Description: structure of a brca2-dss1 complex
PDB Compounds: (B:) breast cancer susceptibility

SCOPe Domain Sequences for d1iyjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyjb1 a.170.1.1 (B:2403-2598) BRCA2 helical domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpqfnkdlmsslqnardlqdiriknkerhhlcpqpgslyltksstlprislqaavgdsvp
sacspkqlymygvskacisvnsknaeyfqfaiedhfgkealcagkgfrladggwlipsdd
gkagkeefyralcdtpgvdpklissvwvsnhyrwivwklaamefafpkefanrclnperv
llqlkyrydveidnss

SCOPe Domain Coordinates for d1iyjb1:

Click to download the PDB-style file with coordinates for d1iyjb1.
(The format of our PDB-style files is described here.)

Timeline for d1iyjb1: