| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (9 families) ![]() |
| Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
| Protein Hypothetical protein RSGI Ruh-001 [81908] (1 species) a Fis1p-like and Cgi-135 homologous domain |
| Species Mouse (Mus musculus) [TaxId:10090] [81909] (1 PDB entry) |
| Domain d1iyga_: 1iyg A: [76947] structural genomics |
PDB Entry: 1iyg (more details)
SCOPe Domain Sequences for d1iyga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iyga_ a.118.8.1 (A:) Hypothetical protein RSGI Ruh-001 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgmeavlnelvsvedlknferkfqseqaagsvskstqfeyawclvrskynedirr
givlleellpkgskeeqrdyvfylavgnyrlkeyekalkyvrgllqtepqnnqakelerl
idkamkksgpssg
Timeline for d1iyga_: