Lineage for d1iyga_ (1iyg A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1096244Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1096245Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 1096269Protein Hypothetical protein RSGI Ruh-001 [81908] (1 species)
    a Fis1p-like and Cgi-135 homologous domain
  7. 1096270Species Mouse (Mus musculus) [TaxId:10090] [81909] (1 PDB entry)
  8. 1096271Domain d1iyga_: 1iyg A: [76947]
    structural genomics

Details for d1iyga_

PDB Entry: 1iyg (more details)

PDB Description: solution structure of rsgi ruh-001, a fis1p-like and cgi-135 homologous domain from a mouse cdna
PDB Compounds: (A:) Hypothetical protein (2010003O14)

SCOPe Domain Sequences for d1iyga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyga_ a.118.8.1 (A:) Hypothetical protein RSGI Ruh-001 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgmeavlnelvsvedlknferkfqseqaagsvskstqfeyawclvrskynedirr
givlleellpkgskeeqrdyvfylavgnyrlkeyekalkyvrgllqtepqnnqakelerl
idkamkksgpssg

SCOPe Domain Coordinates for d1iyga_:

Click to download the PDB-style file with coordinates for d1iyga_.
(The format of our PDB-style files is described here.)

Timeline for d1iyga_: