![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (8 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein Hypothetical protein RSGI Ruh-001 [81908] (1 species) a Fis1p-like and Cgi-135 homologous domain |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [81909] (1 PDB entry) |
![]() | Domain d1iyga_: 1iyg A: [76947] structural genomics |
PDB Entry: 1iyg (more details)
SCOP Domain Sequences for d1iyga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iyga_ a.118.8.1 (A:) Hypothetical protein RSGI Ruh-001 {Mouse (Mus musculus) [TaxId: 10090]} gssgssgmeavlnelvsvedlknferkfqseqaagsvskstqfeyawclvrskynedirr givlleellpkgskeeqrdyvfylavgnyrlkeyekalkyvrgllqtepqnnqakelerl idkamkksgpssg
Timeline for d1iyga_: