Lineage for d1iyga1 (1iyg A:8-127)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2333769Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 protein domains)
  6. 2333798Protein Hypothetical protein RSGI Ruh-001 [81908] (1 species)
    a Fis1p-like and Cgi-135 homologous domain
  7. 2333799Species Mouse (Mus musculus) [TaxId:10090] [81909] (1 PDB entry)
  8. 2333800Domain d1iyga1: 1iyg A:8-127 [76947]
    Other proteins in same PDB: d1iyga2, d1iyga3
    structural genomics

Details for d1iyga1

PDB Entry: 1iyg (more details)

PDB Description: Solution structure of RSGI RUH-001, a Fis1p-like and CGI-135 homologous domain from a mouse cDNA
PDB Compounds: (A:) Hypothetical protein (2010003O14)

SCOPe Domain Sequences for d1iyga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyga1 a.118.8.1 (A:8-127) Hypothetical protein RSGI Ruh-001 {Mouse (Mus musculus) [TaxId: 10090]}
meavlnelvsvedlknferkfqseqaagsvskstqfeyawclvrskynedirrgivllee
llpkgskeeqrdyvfylavgnyrlkeyekalkyvrgllqtepqnnqakelerlidkamkk

SCOPe Domain Coordinates for d1iyga1:

Click to download the PDB-style file with coordinates for d1iyga1.
(The format of our PDB-style files is described here.)

Timeline for d1iyga1: