Lineage for d1iy9b_ (1iy9 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145654Family c.66.1.17: Spermidine synthase [69557] (3 proteins)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 2145659Protein Spermidine synthase [69558] (6 species)
    polyamine aminopropyltransferase
  7. 2145660Species Bacillus subtilis [TaxId:1423] [82478] (1 PDB entry)
  8. 2145662Domain d1iy9b_: 1iy9 B: [76944]
    CASP5

Details for d1iy9b_

PDB Entry: 1iy9 (more details), 2.3 Å

PDB Description: Crystal structure of spermidine synthase
PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d1iy9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iy9b_ c.66.1.17 (B:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]}
selwytekqtknfgitmkvnktlhteqtefqhlemveteefgnmlfldgmvmtsekdefv
yhemvahvplfthpnpehvlvvgggdggvireilkhpsvkkatlvdidgkvieyskkflp
siagklddprvdvqvddgfmhiaksenqydvimvdstepvgpavnlftkgfyagiakalk
edgifvaqtdnpwftpelitnvqrdvkeifpitklytaniptypsglwtftigskkydpl
avedsrffdietkyytkdihkaafvlpkfvsdli

SCOPe Domain Coordinates for d1iy9b_:

Click to download the PDB-style file with coordinates for d1iy9b_.
(The format of our PDB-style files is described here.)

Timeline for d1iy9b_: