Lineage for d1iy9a_ (1iy9 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588626Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 588627Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (41 families) (S)
  5. 588815Family c.66.1.17: Spermidine synthase [69557] (2 proteins)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 588820Protein Spermidine synthase [69558] (4 species)
    polyamine aminopropyltransferase
  7. 588821Species Bacillus subtilis [TaxId:1423] [82478] (1 PDB entry)
  8. 588822Domain d1iy9a_: 1iy9 A: [76943]

Details for d1iy9a_

PDB Entry: 1iy9 (more details), 2.3 Å

PDB Description: Crystal structure of spermidine synthase

SCOP Domain Sequences for d1iy9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis}
selwytekqtknfgitmkvnktlhteqtefqhlemveteefgnmlfldgmvmtsekdefv
yhemvahvplfthpnpehvlvvgggdggvireilkhpsvkkatlvdidgkvieyskkflp
siagklddprvdvqvddgfmhiaksenqydvimvdstepvgpavnlftkgfyagiakalk
edgifvaqtdnpwftpelitnvqrdvkeifpitklytaniptypsglwtftigskkydpl
avedsrffdietkyytkdihkaafvlpkfvsdli

SCOP Domain Coordinates for d1iy9a_:

Click to download the PDB-style file with coordinates for d1iy9a_.
(The format of our PDB-style files is described here.)

Timeline for d1iy9a_: