Lineage for d1iy7a_ (1iy7 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 246616Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 246767Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 246768Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins)
  6. 246769Protein Carboxypeptidase A [53189] (4 species)
  7. 246772Species Cow (Bos taurus) [TaxId:9913] [53190] (25 PDB entries)
  8. 246796Domain d1iy7a_: 1iy7 A: [76942]
    complexed with cxa, zn

Details for d1iy7a_

PDB Entry: 1iy7 (more details), 2 Å

PDB Description: Crystal Structure of CPA and sulfamide-based inhibitor complex

SCOP Domain Sequences for d1iy7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iy7a_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtvnn

SCOP Domain Coordinates for d1iy7a_:

Click to download the PDB-style file with coordinates for d1iy7a_.
(The format of our PDB-style files is described here.)

Timeline for d1iy7a_: