Lineage for d1iy2a_ (1iy2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870969Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2870970Protein AAA domain of cell division protein FtsH [82418] (3 species)
    ATP-dependent protease
  7. 2870989Species Thermus thermophilus [TaxId:274] [82420] (4 PDB entries)
  8. 2870993Domain d1iy2a_: 1iy2 A: [76941]
    complexed with so4

Details for d1iy2a_

PDB Entry: 1iy2 (more details), 3.2 Å

PDB Description: Crystal structure of the FtsH ATPase domain from Thermus thermophilus
PDB Compounds: (A:) ATP-dependent metalloprotease FtsH

SCOPe Domain Sequences for d1iy2a_:

Sequence, based on SEQRES records: (download)

>d1iy2a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}
srarvlteapkvtfkdvagaeeakeelkeiveflknpsrfhemgaripkgvllvgppgvg
kthlaravagearvpfitasgsdfvemfvgvgaarvrdlfetakrhapcivfideidavg
rkrgsgvgggndereqtlnqllvemdgfekdtaivvmaatnrpdildpallrpgrfdrqi
aidapdvkgreqilrihargkplaedvdlallakrtpgfvgadlenllneaallaaregr
rkitmkdleeaas

Sequence, based on observed residues (ATOM records): (download)

>d1iy2a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}
srarvlteapkvtfkdvagaeeakeelkeiveflknpsrfhemgaripkgvllvgppgvg
kthlaravagearvpfitasgsdfvemfvgvgaarvrdlfetakrhapcivfideidavg
rkndereqtlnqllvemdgfekdtaivvmaatnrpdildpallrpgrfdrqiaidapdvk
greqilrihargkplaedvdlallakrtpgfvgadlenllneaallaaregrrkitmkdl
eeaas

SCOPe Domain Coordinates for d1iy2a_:

Click to download the PDB-style file with coordinates for d1iy2a_.
(The format of our PDB-style files is described here.)

Timeline for d1iy2a_: