Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein AAA domain of cell division protein FtsH [82418] (3 species) ATP-dependent protease |
Species Thermus thermophilus [TaxId:274] [82420] (4 PDB entries) |
Domain d1iy1a_: 1iy1 A: [76940] complexed with adp |
PDB Entry: 1iy1 (more details), 2.8 Å
SCOPe Domain Sequences for d1iy1a_:
Sequence, based on SEQRES records: (download)
>d1iy1a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} kvtfkdvagaeeakeelkeiveflknpsrfhemgaripkgvllvgppgvgkthlaravag earvpfitasgsdfvemfvgvgaarvrdlfetakrhapcivfideidavgrkrgsgvggg ndereqtlnqllvemdgfekdtaivvmaatnrpdildpallrpgrfdrqiaidapdvkgr eqilrihargkplaedvdlallakrtpgfvgadlenllneaallaaregrrkitmkdlee aas
>d1iy1a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} kvtfkdvagaeeakeelkeiveflknpsrfhemgaripkgvllvgppgvgkthlaravag earvpfitasgsdfvemfvgvgaarvrdlfetakrhapcivfideidavgrndereqtln qllvemdgfekdtaivvmaatnrpdildpallrpgrfdrqiaidapdvkgreqilrihar gkplaedvdlallakrtpgfvgadlenllneaallaaregrrkitmkdleeaas
Timeline for d1iy1a_: