SCOP 1.67: Domain d1iy1a_: 1iy1 A:

Lineage for d1iy1a_ (1iy1 A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (18 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein AAA domain of cell division protein FtsH [82418] (2 species)
   ATP-dependent protease

7. Species Thermus thermophilus [TaxId:274] [82420] (4 PDB entries)

8. Domain d1iy1a_: 1iy1 A: [76940]
   complexed with adp

Details for d1iy1a_

PDB Entry: 1iy1, 2.8 Å

PDB Description: Crystal structure of the FtsH ATPase domain with ADP from Thermus thermophilus

SCOP Domain Sequences for d1iy1a_:

Sequence, based on SEQRES records:

>d1iy1a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus}
kvtfkdvagaeeakeelkeiveflknpsrfhemgaripkgvllvgppgvgkthlaravag
earvpfitasgsdfvemfvgvgaarvrdlfetakrhapcivfideidavgrkrgsgvggg
ndereqtlnqllvemdgfekdtaivvmaatnrpdildpallrpgrfdrqiaidapdvkgr
eqilrihargkplaedvdlallakrtpgfvgadlenllneaallaaregrrkitmkdlee
aas

Sequence, based on observed residues (ATOM records):

>d1iy1a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus}
kvtfkdvagaeeakeelkeiveflknpsrfhemgaripkgvllvgppgvgkthlaravag
earvpfitasgsdfvemfvgvgaarvrdlfetakrhapcivfideidavgrndereqtln
qllvemdgfekdtaivvmaatnrpdildpallrpgrfdrqiaidapdvkgreqilrihar
gkplaedvdlallakrtpgfvgadlenllneaallaaregrrkitmkdleeaas

Timeline for d1iy1a_:

• d1iy1a_ first appeared in SCOP 1.63
  
• d1iy1a_ appears in SCOP 1.65
  
• d1iy1a_ appears in SCOP 1.69
  
• d1iy1a_ appears in the current release, SCOPe 2.08