SCOP 1.71: Domain d1iy0a_: 1iy0 A:

Lineage for d1iy0a_ (1iy0 A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (26 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein AAA domain of cell division protein FtsH [82418] (2 species)
   ATP-dependent protease

7. Species Thermus thermophilus [TaxId:274] [82420] (4 PDB entries)

8. Domain d1iy0a_: 1iy0 A: [76939]
   complexed with anp

Details for d1iy0a_

PDB Entry: 1iy0, 2.95 Å

PDB Description: Crystal structure of the FtsH ATPase domain with AMP-PNP from Thermus thermophilus

SCOP Domain Sequences for d1iy0a_:

Sequence, based on SEQRES records:

>d1iy0a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus}
teapkvtfkdvagaeeakeelkeiveflknpsrfhemgaripkgvllvgppgvgkthlar
avagearvpfitasgsdfvemfvgvgaarvrdlfetakrhapcivfideidavgrkrgsg
vgggndereqtlnqllvemdgfekdtaivvmaatnrpdildpallrpgrfdrqiaidapd
vkgreqilrihargkplaedvdlallakrtpgfvgadlenllneaallaaregrrkitmk
dleeaas

Sequence, based on observed residues (ATOM records):

>d1iy0a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus}
teapkvtfkdvagaeeakeelkeiveflknpsrfhemgaripkgvllvgppgvgkthlar
avagearvpfitasgsdfvemfvgvgaarvrdlfetakrhapcivfideidavgrkrnde
reqtlnqllvemdgfekdtaivvmaatnrpdildpallrpgrfdrqiaidapdvkgreqi
lrihargkplaedvdlallakrtpgfvgadlenllneaallaaregrrkitmkdleeaas

Timeline for d1iy0a_:

• d1iy0a_ first appeared in SCOP 1.63
  
• d1iy0a_ appears in SCOP 1.69
  
• d1iy0a_ appears in SCOP 1.73
  
• d1iy0a_ appears in the current release, SCOPe 2.08