Lineage for d1iy0a_ (1iy0 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 244141Family c.37.1.20: Extended AAA-ATPase domain [81269] (14 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 244142Protein AAA domain of cell division protein FtsH [82418] (2 species)
    ATP-dependent protease
  7. 244145Species Thermus thermophilus [TaxId:274] [82420] (4 PDB entries)
  8. 244148Domain d1iy0a_: 1iy0 A: [76939]
    complexed with anp

Details for d1iy0a_

PDB Entry: 1iy0 (more details), 2.95 Å

PDB Description: Crystal structure of the FtsH ATPase domain with AMP-PNP from Thermus thermophilus
PDB Compounds: (A:)

SCOP Domain Sequences for d1iy0a_:

Sequence, based on SEQRES records: (download)

>d1iy0a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus}
teapkvtfkdvagaeeakeelkeiveflknpsrfhemgaripkgvllvgppgvgkthlar
avagearvpfitasgsdfvemfvgvgaarvrdlfetakrhapcivfideidavgrkrgsg
vgggndereqtlnqllvemdgfekdtaivvmaatnrpdildpallrpgrfdrqiaidapd
vkgreqilrihargkplaedvdlallakrtpgfvgadlenllneaallaaregrrkitmk
dleeaas

Sequence, based on observed residues (ATOM records): (download)

>d1iy0a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus}
teapkvtfkdvagaeeakeelkeiveflknpsrfhemgaripkgvllvgppgvgkthlar
avagearvpfitasgsdfvemfvgvgaarvrdlfetakrhapcivfideidavgrkrnde
reqtlnqllvemdgfekdtaivvmaatnrpdildpallrpgrfdrqiaidapdvkgreqi
lrihargkplaedvdlallakrtpgfvgadlenllneaallaaregrrkitmkdleeaas

SCOP Domain Coordinates for d1iy0a_:

Click to download the PDB-style file with coordinates for d1iy0a_.
(The format of our PDB-style files is described here.)

Timeline for d1iy0a_: