Lineage for d1ixya_ (1ixy A:)
- Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
consists of two non-similar domains with 3 layers (a/b/a) each
domain 1: parallel beta-sheet of 7 strands, order 3214567
domain 2: parallel beta-sheet of 6 strands, order 321456Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (6 families) 
Family c.87.1.1: beta-Glucosyltransferase (DNA-modifying) [53757] (1 protein) Protein beta-Glucosyltransferase (DNA-modifying) [53758] (1 species) Species Bacteriophage T4 [TaxId:10665] [53759] (14 PDB entries) 
Domain d1ixya_: 1ixy A: [76936]
Details for d1ixya_
PDB Entry: 1ixy (more details), 2.5 Å
PDB Description: Ternary complex of T4 phage BGT with UDP and a 13 mer DNA duplex
SCOP Domain Sequences for d1ixya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixya_ c.87.1.1 (A:) beta-Glucosyltransferase (DNA-modifying) {Bacteriophage T4}
mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl
yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl
SCOP Domain Coordinates for d1ixya_:
Click to download the PDB-style file with coordinates for d1ixya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ixya_:
- d1ixya_ is new in SCOP 1.63
- d1ixya_ appears in SCOP 1.65
- d1ixya_ appears in the current release, SCOPe 2.08
View in 3D
