![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
![]() | Protein Holliday junction helicase RuvB [52713] (2 species) contains "winged helix" DNA-binding domain after the family specific domains |
![]() | Species Thermus thermophilus [TaxId:274] [52714] (3 PDB entries) |
![]() | Domain d1ixsb2: 1ixs B:4-242 [76934] Other proteins in same PDB: d1ixsa_, d1ixsb1 complexed with anp |
PDB Entry: 1ixs (more details), 3.2 Å
SCOPe Domain Sequences for d1ixsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} lalrpktldeyigqerlkqklrvyleaakarkeplehlllfgppglgkttlahviahelg vnlrvtsgpaiekpgdlaailansleegdilfideihrlsrqaeehlypamedfvmdivi gqgpaartirlelprftligattrpglitapllsrfgivehleyytpeelaqgvmrdarl lgvriteeaaleigrrsrgtmrvakrlfrrvrdfaqvageevitreralealaalglde
Timeline for d1ixsb2: