Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins) follows the extended AAA-ATPase domain |
Protein Holliday junction helicase RuvB [46820] (2 species) |
Species Thermus thermophilus [TaxId:274] [46821] (3 PDB entries) |
Domain d1ixsb1: 1ixs B:243-318 [76933] Other proteins in same PDB: d1ixsa_, d1ixsb2 complexed with anp |
PDB Entry: 1ixs (more details), 3.2 Å
SCOPe Domain Sequences for d1ixsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixsb1 a.4.5.11 (B:243-318) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} lglekrdreilevlilrfgggpvglatlatalsedpgtleevhepylirqgllkrtprgr vatelayrhlgypppv
Timeline for d1ixsb1: