SCOPe 2.06: Domain d1ixsa_: 1ixs A:

Lineage for d1ixsa_ (1ixs A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.1: DNA helicase RuvA subunit, C-terminal domain [46929] (1 family)
   possibly related to UBA-like domains

5. Family a.5.1.1: DNA helicase RuvA subunit, C-terminal domain [46930] (1 protein)

6. Protein DNA helicase RuvA subunit, C-terminal domain [46931] (3 species)
   tetramer; binds Holliday junction

7. Species Thermus thermophilus [TaxId:274] [81702] (2 PDB entries)

8. Domain d1ixsa_: 1ixs A: [76932]
   Other proteins in same PDB: d1ixsb1, d1ixsb2
   complexed with anp

Details for d1ixsa_

PDB Entry: 1ixs, 3.2 Å

PDB Description: Structure of RuvB complexed with RuvA domain III

PDB Compounds: (A:) holliday junction DNA helicase ruva

SCOPe Domain Sequences for d1ixsa_:

Sequence; same for both SEQRES and ATOM records:

>d1ixsa_ a.5.1.1 (A:) DNA helicase RuvA subunit, C-terminal domain {Thermus thermophilus [TaxId: 274]}
eseaaeeavmalaalgfkeaqaravvldllaqnpkaraqdlikealkrlr

Timeline for d1ixsa_:

• d1ixsa_ first appeared in SCOP 1.63
  
• d1ixsa_ appears in SCOPe 2.05
  
• d1ixsa_ appears in the current release, SCOPe 2.07